SCOPe 2.07: Domain d1w9qa1: 1w9q A:113-194

Lineage for d1w9qa1 (1w9q A:113-194)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Syntenin 1 [89311] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries)

8. Domain d1w9qa1: 1w9q A:113-194 [120791]
   Other proteins in same PDB: d1w9qa3, d1w9qb3
   automated match to d1obza1
   complexed with bez

Details for d1w9qa1

PDB Entry: 1w9q, 1.7 Å

PDB Description: crystal structure of the pdz tandem of human syntenin in complex with tnefaf peptide

PDB Compounds: (A:) Syntenin 1

SCOPe Domain Sequences for d1w9qa1:

Sequence; same for both SEQRES and ATOM records:

>d1w9qa1 b.36.1.1 (A:113-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}
revilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingencagwssd
kahkvlkqafgekitmtirdrp

Timeline for d1w9qa1:

• d1w9qa1 first appeared in SCOP 1.73
  
• d1w9qa1 appears in SCOPe 2.06
  
• d1w9qa1 appears in the current release, SCOPe 2.08