Lineage for d1w9ea2 (1w9e A:197-273)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 797796Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 797797Superfamily b.36.1: PDZ domain-like [50156] (6 families) (S)
    peptide-binding domain
  5. 797798Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 798004Protein Syntenin 1 [89311] (1 species)
  7. 798005Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries)
  8. 798010Domain d1w9ea2: 1w9e A:197-273 [120780]
    automatically matched to d1ntea_
    complexed with bez

Details for d1w9ea2

PDB Entry: 1w9e (more details), 1.56 Å

PDB Description: crystal structure of the pdz tandem of human syntenin in complex with tnefyf peptide
PDB Compounds: (A:) Syntenin 1

SCOP Domain Sequences for d1w9ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w9ea2 b.36.1.1 (A:197-273) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}
rtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqiad
ilstsgtvvtitimpaf

SCOP Domain Coordinates for d1w9ea2:

Click to download the PDB-style file with coordinates for d1w9ea2.
(The format of our PDB-style files is described here.)

Timeline for d1w9ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w9ea1