SCOP 1.75: Domain d1w9eb2: 1w9e B:197-273

Lineage for d1w9eb2 (1w9e B:197-273)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (6 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (46 proteins)
   Pfam PF00595

6. Protein Syntenin 1 [89311] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries)

8. Domain d1w9eb2: 1w9e B:197-273 [120782]
   automatically matched to d1ntea_
   complexed with bez

Details for d1w9eb2

PDB Entry: 1w9e, 1.56 Å

PDB Description: crystal structure of the pdz tandem of human syntenin in complex with tnefyf peptide

PDB Compounds: (B:) Syntenin 1

SCOP Domain Sequences for d1w9eb2:

Sequence; same for both SEQRES and ATOM records:

>d1w9eb2 b.36.1.1 (B:197-273) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}
rtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqiad
ilstsgtvvtitimpaf

Timeline for d1w9eb2:

• d1w9eb2 first appeared in SCOP 1.73
  
• d1w9eb2 appears in SCOPe 2.01
  
• d1w9eb2 appears in the current release, SCOPe 2.08