SCOP 1.73: Domain d1w8rc1: 1w8r C:3-252

Lineage for d1w8rc1 (1w8r C:3-252)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (8 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (12 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Archaeal fructose 1,6-bisphosphate aldolase [102088] (1 species)

7. Species Archaeon Thermoproteus tenax [TaxId:2271] [102089] (5 PDB entries)

8. Domain d1w8rc1: 1w8r C:3-252 [120736]
   automatically matched to 1W8R A:3-252
   complexed with f2p; mutant

Details for d1w8rc1

PDB Entry: 1w8r, 1.93 Å

PDB Description: the mechanism of the schiff base forming fructose-1,6-bisphosphate aldolase: structural analysis of reaction intermediates

PDB Compounds: (C:) fructose-bisphosphate aldolase class I

SCOP Domain Sequences for d1w8rc1:

Sequence; same for both SEQRES and ATOM records:

>d1w8rc1 c.1.10.1 (C:3-252) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]}
nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
mfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgadamkikytg
dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
faralaelvy

Timeline for d1w8rc1:

• d1w8rc1 is new in SCOP 1.73
  
• d1w8rc1 last appears in SCOP 1.75