Lineage for d1w8rd1 (1w8r D:3-252)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683918Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 683919Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 683938Protein Archaeal fructose 1,6-bisphosphate aldolase [102088] (1 species)
  7. 683939Species Archaeon Thermoproteus tenax [TaxId:2271] [102089] (5 PDB entries)
  8. 683963Domain d1w8rd1: 1w8r D:3-252 [120737]
    automatically matched to 1W8R A:3-252
    complexed with f2p; mutant

Details for d1w8rd1

PDB Entry: 1w8r (more details), 1.93 Å

PDB Description: the mechanism of the schiff base forming fructose-1,6-bisphosphate aldolase: structural analysis of reaction intermediates
PDB Compounds: (D:) fructose-bisphosphate aldolase class I

SCOP Domain Sequences for d1w8rd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w8rd1 c.1.10.1 (D:3-252) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]}
nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
mfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgadamkikytg
dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
faralaelvy

SCOP Domain Coordinates for d1w8rd1:

Click to download the PDB-style file with coordinates for d1w8rd1.
(The format of our PDB-style files is described here.)

Timeline for d1w8rd1: