Lineage for d1w6tb1 (1w6t B:138-433)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1573508Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1573509Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 1573510Protein Enolase [51606] (9 species)
    Fold of this protein slightly differs from common fold in topology
  7. 1573576Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141843] (1 PDB entry)
    Uniprot Q8DPS0 138-433
  8. 1573578Domain d1w6tb1: 1w6t B:138-433 [120672]
    Other proteins in same PDB: d1w6ta2, d1w6tb2
    automated match to d1w6ta1
    complexed with 2pe, mg

Details for d1w6tb1

PDB Entry: 1w6t (more details), 2.1 Å

PDB Description: crystal structure of octameric enolase from streptococcus pneumoniae
PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d1w6tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w6tb1 c.1.11.1 (B:138-433) Enolase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ntkvlptpmmniinggshsdapiafqefmilpvgaptfkealrygaeifhalkkilksrg
letavgdeggfaprfegtedgvetilaaieaagyvpgkdvflgfdcassefydkerkvyd
ytkfegegaavrtsaeqidyleelvnkypiitiedgmdendwdgwkalterlgkkvqlvg
ddffvtntdylargiqegaansilikvnqigtltetfeaiemakeagytavvshrsgete
dstiadiavatnagqiktgslsrtdriakynqllriedqlgevaeyrglksfynlk

SCOPe Domain Coordinates for d1w6tb1:

Click to download the PDB-style file with coordinates for d1w6tb1.
(The format of our PDB-style files is described here.)

Timeline for d1w6tb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w6tb2