Class a: All alpha proteins [46456] (284 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) |
Family a.102.4.4: Complement components [48251] (3 proteins) probably related to other families, but has no known enzymatic activity |
Protein C3D, a C3 fragment and ligand for complement receptor 2 [48252] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48253] (12 PDB entries) |
Domain d1w2sa1: 1w2s A:1-307 [120604] Other proteins in same PDB: d1w2sb1, d1w2sb2 automatically matched to d1ghqa_ |
PDB Entry: 1w2s (more details)
SCOPe Domain Sequences for d1w2sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w2sa1 a.102.4.4 (A:1-307) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens) [TaxId: 9606]} mldaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgy tqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqk pdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkag dfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveat syallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdapsdhqel nldvslq
Timeline for d1w2sa1: