Lineage for d1w2sa1 (1w2s A:1-307)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276656Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1276995Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1277270Family a.102.4.4: Complement components [48251] (3 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 1277271Protein C3D, a C3 fragment and ligand for complement receptor 2 [48252] (2 species)
  7. 1277272Species Human (Homo sapiens) [TaxId:9606] [48253] (12 PDB entries)
  8. 1277293Domain d1w2sa1: 1w2s A:1-307 [120604]
    Other proteins in same PDB: d1w2sb1, d1w2sb2
    automatically matched to d1ghqa_

Details for d1w2sa1

PDB Entry: 1w2s (more details)

PDB Description: solution structure of cr2 scr 1-2 in its complex with c3d by x-ray scattering
PDB Compounds: (A:) complement c3 precursor

SCOPe Domain Sequences for d1w2sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2sa1 a.102.4.4 (A:1-307) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens) [TaxId: 9606]}
mldaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgy
tqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqk
pdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkag
dfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveat
syallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdapsdhqel
nldvslq

SCOPe Domain Coordinates for d1w2sa1:

Click to download the PDB-style file with coordinates for d1w2sa1.
(The format of our PDB-style files is described here.)

Timeline for d1w2sa1: