Class g: Small proteins [56992] (85 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) |
Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins) Pfam PF00084 |
Protein Complement receptor 2, cr2 [64564] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64565] (4 PDB entries) |
Domain d1w2ra1: 1w2r A:6-69 [120602] automatically matched to d1ly2a1 |
PDB Entry: 1w2r (more details)
SCOP Domain Sequences for d1w2ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w2ra1 g.18.1.1 (A:6-69) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} scgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwdkpapk cqyf
Timeline for d1w2ra1: