Lineage for d1w2me2 (1w2m E:177-439)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732939Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 732940Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 732941Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 732942Protein Aminopeptidase P, C-terminal domain [55928] (2 species)
  7. 732946Species Escherichia coli [TaxId:562] [55929] (23 PDB entries)
  8. 732970Domain d1w2me2: 1w2m E:177-439 [120599]
    Other proteins in same PDB: d1w2ma1, d1w2mb1, d1w2mc1, d1w2md1, d1w2me1, d1w2mf1
    automatically matched to d1a16_2
    complexed with ca, cl, ipa

Details for d1w2me2

PDB Entry: 1w2m (more details), 2.4 Å

PDB Description: ca-substituted form of e. coli aminopeptidase p
PDB Compounds: (E:) xaa-pro aminopeptidase

SCOP Domain Sequences for d1w2me2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2me2 d.127.1.1 (E:177-439) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaark

SCOP Domain Coordinates for d1w2me2:

Click to download the PDB-style file with coordinates for d1w2me2.
(The format of our PDB-style files is described here.)

Timeline for d1w2me2: