SCOP 1.73: Domain d1w2mc2: 1w2m C:177-439

Lineage for d1w2mc2 (1w2m C:177-439)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)

6. Protein Aminopeptidase P, C-terminal domain [55928] (2 species)

7. Species Escherichia coli [TaxId:562] [55929] (23 PDB entries)

8. Domain d1w2mc2: 1w2m C:177-439 [120595]
   Other proteins in same PDB: d1w2ma1, d1w2mb1, d1w2mc1, d1w2md1, d1w2me1, d1w2mf1
   automatically matched to d1a16_2
   complexed with ca, cl, ipa

Details for d1w2mc2

PDB Entry: 1w2m, 2.4 Å

PDB Description: ca-substituted form of e. coli aminopeptidase p

PDB Compounds: (C:) xaa-pro aminopeptidase

SCOP Domain Sequences for d1w2mc2:

Sequence; same for both SEQRES and ATOM records:

>d1w2mc2 d.127.1.1 (C:177-439) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaark

Timeline for d1w2mc2:

• d1w2mc2 is new in SCOP 1.73
  
• d1w2mc2 appears in SCOP 1.75
  
• d1w2mc2 appears in the current release, SCOPe 2.08