SCOPe 2.08: Domain d1vyjg2: 1vyj G:127-260

Lineage for d1vyjg2 (1vyj G:127-260)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55991] (10 PDB entries)
   Uniprot P12004

8. Domain d1vyjg2: 1vyj G:127-260 [120537]
   automated match to d1u7ba2
   protein/DNA complex

Details for d1vyjg2

PDB Entry: 1vyj, 2.8 Å

PDB Description: structural and biochemical studies of human pcna complexes provide the basis for association with cdk/cyclin and rationale for inhibitor design

PDB Compounds: (G:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d1vyjg2:

Sequence; same for both SEQRES and ATOM records:

>d1vyjg2 d.131.1.2 (G:127-260) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
lkyylapkiedeeg

Timeline for d1vyjg2:

• d1vyjg2 first appeared in SCOP 1.73
  
• d1vyjg2 appears in SCOPe 2.07