Lineage for d1vrxb1 (1vrx B:1-358)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 815744Family c.1.8.3: beta-glycanases [51487] (26 proteins)
    consist of a number of sequence families
  6. 815994Protein Endocellulase E1 [51497] (1 species)
  7. 815995Species Acidothermus cellulolyticus [TaxId:28049] [51498] (2 PDB entries)
  8. 815999Domain d1vrxb1: 1vrx B:1-358 [120487]
    automatically matched to d1c0da_
    mutant

Details for d1vrxb1

PDB Entry: 1vrx (more details), 2.4 Å

PDB Description: endocellulase e1 from acidothermus cellulolyticus mutant y245g
PDB Compounds: (B:) endocellulase e1 from a. cellulolyticus

SCOP Domain Sequences for d1vrxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrxb1 c.1.8.3 (B:1-358) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]}
agggywhtsgreildannvpvriaginwfgfetcnyvvhglwsrdyrsmldqikslgynt
irlpysddilkpgtmpnsinfyqmnqdlqgltslqvmdkivayagqiglriildrhrpdc
sgqsalwytssvseatwisdlqalaqrykgnptvvgfdlhnephdpacwgcgdpsidwrl
aaeragnavlsvnpnllifvegvqsyngdsywwggnlqgagqypvvlnvpnrlvysahdy
atsvgpqtwfsdptfpnnmpgiwnknwgylfnqniapvwlgefgttlqsttdqtwlktlv
qylrptaqygadsfqwtfwswnpdsgdtggilkddwqtvdtdkdgylapikssifdpv

SCOP Domain Coordinates for d1vrxb1:

Click to download the PDB-style file with coordinates for d1vrxb1.
(The format of our PDB-style files is described here.)

Timeline for d1vrxb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vrxa1