SCOP 1.73: Domain d1vrxb1: 1vrx B:1-358

Lineage for d1vrxb1 (1vrx B:1-358)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.3: beta-glycanases [51487] (24 proteins)
   consist of a number of sequence families

6. Protein Endocellulase E1 [51497] (1 species)

7. Species Acidothermus cellulolyticus [TaxId:28049] [51498] (2 PDB entries)

8. Domain d1vrxb1: 1vrx B:1-358 [120487]
   automatically matched to d1c0da_
   mutant

Details for d1vrxb1

PDB Entry: 1vrx, 2.4 Å

PDB Description: endocellulase e1 from acidothermus cellulolyticus mutant y245g

PDB Compounds: (B:) endocellulase e1 from a. cellulolyticus

SCOP Domain Sequences for d1vrxb1:

Sequence; same for both SEQRES and ATOM records:

>d1vrxb1 c.1.8.3 (B:1-358) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]}
agggywhtsgreildannvpvriaginwfgfetcnyvvhglwsrdyrsmldqikslgynt
irlpysddilkpgtmpnsinfyqmnqdlqgltslqvmdkivayagqiglriildrhrpdc
sgqsalwytssvseatwisdlqalaqrykgnptvvgfdlhnephdpacwgcgdpsidwrl
aaeragnavlsvnpnllifvegvqsyngdsywwggnlqgagqypvvlnvpnrlvysahdy
atsvgpqtwfsdptfpnnmpgiwnknwgylfnqniapvwlgefgttlqsttdqtwlktlv
qylrptaqygadsfqwtfwswnpdsgdtggilkddwqtvdtdkdgylapikssifdpv

Timeline for d1vrxb1:

• d1vrxb1 is new in SCOP 1.73
  
• d1vrxb1 appears in SCOP 1.75
  
• d1vrxb1 appears in the current release, SCOPe 2.08, called d1vrxb_