![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
![]() | Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (2 species) |
![]() | Species Escherichia coli [TaxId:316407] [186806] (1 PDB entry) |
![]() | Domain d1vrsd_: 1vrs D: [120481] Other proteins in same PDB: d1vrsa_, d1vrsb_, d1vrsc_ automated match to d1uc7a_ |
PDB Entry: 1vrs (more details), 2.85 Å
SCOPe Domain Sequences for d1vrsd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vrsd_ c.47.1.1 (D:) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 316407]} hlnftqiktvdelnqalveakgkpvmldlyadwcvaskefekytfsdpqvqkaladtvll qanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdrq
Timeline for d1vrsd_: