SCOPe 2.08: Domain d1vrsd_: 1vrs D:

Lineage for d1vrsd_ (1vrs D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (2 species)

7. Species Escherichia coli [TaxId:316407] [186806] (2 PDB entries)

8. Domain d1vrsd_: 1vrs D: [120481]
   Other proteins in same PDB: d1vrsa_, d1vrsb_, d1vrsc_
   automated match to d1uc7a_

Details for d1vrsd_

PDB Entry: 1vrs, 2.85 Å

PDB Description: crystal structure of the disulfide-linked complex between the n- terminal and c-terminal domain of the electron transfer catalyst dsbd

PDB Compounds: (D:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d1vrsd_:

Sequence; same for both SEQRES and ATOM records:

>d1vrsd_ c.47.1.1 (D:) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 316407]}
hlnftqiktvdelnqalveakgkpvmldlyadwcvaskefekytfsdpqvqkaladtvll
qanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdrq

Timeline for d1vrsd_:

• d1vrsd_ first appeared in SCOP 1.73, called d1vrsd1
  
• d1vrsd_ appears in SCOPe 2.07