SCOP 1.73: Domain d1vr4e1: 1vr4 E:1-103

Lineage for d1vr4e1 (1vr4 E:1-103)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.230: Dodecin subunit-like [88797] (5 superfamilies)
   beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132

4. Superfamily d.230.5: YbjQ-like [117782] (1 family)
   pentamer, beta/alpha-propeller; additional short beta-strands promote oligomeric assembly

5. Family d.230.5.1: YbjQ-like [117783] (2 proteins)
   Pfam PF01906; DUF 74, UPF0145

6. Protein Hypothetical protein BC1012 [142892] (1 species)

7. Species Bacillus cereus [TaxId:1396] [142893] (1 PDB entry)

8. Domain d1vr4e1: 1vr4 E:1-103 [120436]
   automatically matched to 1VR4 A:1-103

Details for d1vr4e1

PDB Entry: 1vr4, 2.09 Å

PDB Description: crystal structure of mcsg target apc22750 from bacillus cereus

PDB Compounds: (E:) hypothetical protein APC22750

SCOP Domain Sequences for d1vr4e1:

Sequence, based on SEQRES records:

>d1vr4e1 d.230.5.1 (E:1-103) Hypothetical protein BC1012 {Bacillus cereus [TaxId: 1396]}
mivtttsgiqgkeiieyidivngeaimganivrdlfasvrdvvggragsyesklkeardi
amdemkelakqkganaivgvdvdyevvrdgmlmvavsgtavri

Sequence, based on observed residues (ATOM records):

>d1vr4e1 d.230.5.1 (E:1-103) Hypothetical protein BC1012 {Bacillus cereus [TaxId: 1396]}
mivtttsgiqgkeiieyidivngeaimgardvvggragsyesklkeardiamdemkelak
qkganaivgvdvdyevvrdgmlmvavsgtavri

Timeline for d1vr4e1:

• d1vr4e1 is new in SCOP 1.73
  
• d1vr4e1 appears in SCOP 1.75
  
• d1vr4e1 appears in the current release, SCOPe 2.08, called d1vr4e_