Lineage for d1vr4d1 (1vr4 D:1-103)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740555Fold d.230: Dodecin subunit-like [88797] (5 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 740602Superfamily d.230.5: YbjQ-like [117782] (1 family) (S)
    pentamer, beta/alpha-propeller; additional short beta-strands promote oligomeric assembly
  5. 740603Family d.230.5.1: YbjQ-like [117783] (2 proteins)
    Pfam PF01906; DUF 74, UPF0145
  6. 740604Protein Hypothetical protein BC1012 [142892] (1 species)
  7. 740605Species Bacillus cereus [TaxId:1396] [142893] (1 PDB entry)
  8. 740609Domain d1vr4d1: 1vr4 D:1-103 [120435]
    automatically matched to 1VR4 A:1-103

Details for d1vr4d1

PDB Entry: 1vr4 (more details), 2.09 Å

PDB Description: crystal structure of mcsg target apc22750 from bacillus cereus
PDB Compounds: (D:) hypothetical protein APC22750

SCOP Domain Sequences for d1vr4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vr4d1 d.230.5.1 (D:1-103) Hypothetical protein BC1012 {Bacillus cereus [TaxId: 1396]}
mivtttsgiqgkeiieyidivngeaimganivrdlfasvrdvvggragsyesklkeardi
amdemkelakqkganaivgvdvdyevvrdgmlmvavsgtavri

SCOP Domain Coordinates for d1vr4d1:

Click to download the PDB-style file with coordinates for d1vr4d1.
(The format of our PDB-style files is described here.)

Timeline for d1vr4d1: