![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.148: ComB-like [142822] (1 superfamily) contains of two similar intertwined domains related by pseudo dyad; duplication; core: 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.148.1: ComB-like [142823] (1 family) ![]() automatically mapped to Pfam PF04029 |
![]() | Family c.148.1.1: ComB-like [142824] (1 protein) Pfam PF04029; 2-phosphosulpholactate phosphatase |
![]() | Protein 2-phosphosulfolactate phosphatase ComB [142825] (1 species) |
![]() | Species Clostridium acetobutylicum [TaxId:1488] [142826] (1 PDB entry) Uniprot Q97E82 1-235 |
![]() | Domain d1vr0b_: 1vr0 B: [120429] Other proteins in same PDB: d1vr0a2, d1vr0c3 automated match to d1vr0a1 complexed with 3sl, mg |
PDB Entry: 1vr0 (more details), 2.49 Å
SCOPe Domain Sequences for d1vr0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vr0b_ c.148.1.1 (B:) 2-phosphosulfolactate phosphatase ComB {Clostridium acetobutylicum [TaxId: 1488]} mkidliisaddikeekvknktavvidmlratsvittalnngckrvvpvltveealkkvke ygkdailggerkglkiegfdfsnspmeytedvvkgktlimtttngtraikgsetardili gsvlngeavaekivelnndvvivnagtygefsiddficsgyiincvmdrmkkleltdaat taqyvyktnedikgfvkyakhykrimelglkkdfeycckkdivklvpqytngeil
Timeline for d1vr0b_:
![]() Domains from other chains: (mouse over for more information) d1vr0a1, d1vr0a2, d1vr0c2, d1vr0c3 |