PDB entry 1vr0

View 1vr0 on RCSB PDB site
Description: Crystal structure of putative 2-phosphosulfolactate phosphatase (15026306) from Clostridium acetobutylicum at 2.6 A resolution
Class: hydrolase
Keywords: 15026306, putative 2-phosphosulfolactate phosphatase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, HYDROLASE
Deposited on 2005-01-26, released 2005-02-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.4899999999999998 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable 2-phosphosulfolactate phosphatase
    Species: Clostridium acetobutylicum [TaxId:1488]
    Gene: comB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97E82 (12-246)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (38)
      • modified residue (97)
      • modified residue (111)
      • modified residue (178)
      • modified residue (181)
      • modified residue (217)
    Domains in SCOPe 2.08: d1vr0a1, d1vr0a2
  • Chain 'B':
    Compound: Probable 2-phosphosulfolactate phosphatase
    Species: Clostridium acetobutylicum [TaxId:1488]
    Gene: comB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97E82 (12-246)
      • modified residue (12)
      • modified residue (38)
      • modified residue (97)
      • modified residue (111)
      • modified residue (178)
      • modified residue (181)
      • modified residue (217)
    Domains in SCOPe 2.08: d1vr0b_
  • Chain 'C':
    Compound: Probable 2-phosphosulfolactate phosphatase
    Species: Clostridium acetobutylicum [TaxId:1488]
    Gene: comB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97E82 (12-246)
      • leader sequence (10-11)
      • modified residue (12)
      • modified residue (38)
      • modified residue (97)
      • modified residue (111)
      • modified residue (178)
      • modified residue (181)
      • modified residue (217)
    Domains in SCOPe 2.08: d1vr0c2, d1vr0c3
  • Heterogens: MG, 3SL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vr0A (A:)
    mgsdkihhhhhhmkidliisaddikeekvknktavvidmlratsvittalnngckrvvpv
    ltveealkkvkeygkdailggerkglkiegfdfsnspmeytedvvkgktlimtttngtra
    ikgsetardiligsvlngeavaekivelnndvvivnagtygefsiddficsgyiincvmd
    rmkkleltdaattaqyvyktnedikgfvkyakhykrimelglkkdfeycckkdivklvpq
    ytngeil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vr0A (A:)
    hmkidliisaddikeekvknktavvidmlratsvittalnngckrvvpvltveealkkvk
    eygkdailggerkglkiegfdfsnspmeytedvvkgktlimtttngtraikgsetardil
    igsvlngeavaekivelnndvvivnagtygefsiddficsgyiincvmdrmkkleltdaa
    ttaqyvyktnedikgfvkyakhykrimelglkkdfeycckkdivklvpqytngeil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vr0B (B:)
    mgsdkihhhhhhmkidliisaddikeekvknktavvidmlratsvittalnngckrvvpv
    ltveealkkvkeygkdailggerkglkiegfdfsnspmeytedvvkgktlimtttngtra
    ikgsetardiligsvlngeavaekivelnndvvivnagtygefsiddficsgyiincvmd
    rmkkleltdaattaqyvyktnedikgfvkyakhykrimelglkkdfeycckkdivklvpq
    ytngeil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vr0B (B:)
    mkidliisaddikeekvknktavvidmlratsvittalnngckrvvpvltveealkkvke
    ygkdailggerkglkiegfdfsnspmeytedvvkgktlimtttngtraikgsetardili
    gsvlngeavaekivelnndvvivnagtygefsiddficsgyiincvmdrmkkleltdaat
    taqyvyktnedikgfvkyakhykrimelglkkdfeycckkdivklvpqytngeil
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vr0C (C:)
    mgsdkihhhhhhmkidliisaddikeekvknktavvidmlratsvittalnngckrvvpv
    ltveealkkvkeygkdailggerkglkiegfdfsnspmeytedvvkgktlimtttngtra
    ikgsetardiligsvlngeavaekivelnndvvivnagtygefsiddficsgyiincvmd
    rmkkleltdaattaqyvyktnedikgfvkyakhykrimelglkkdfeycckkdivklvpq
    ytngeil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vr0C (C:)
    hhmkidliisaddikeekvknktavvidmlratsvittalnngckrvvpvltveealkkv
    keygkdailggerkglkiegfdfsnspmeytedvvkgktlimtttngtraikgsetardi
    ligsvlngeavaekivelnndvvivnagtygefsiddficsgyiincvmdrmkkleltda
    attaqyvyktnedikgfvkyakhykrimelglkkdfeycckkdivklvpqytngeil