Lineage for d1vq5t1 (1vq5 T:1-119)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783937Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2783938Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 2783981Protein Ribosomal proteins L24 (L24p) [50106] (4 species)
  7. 2784021Species Haloarcula marismortui [TaxId:2238] [50107] (40 PDB entries)
    Uniprot P10972
  8. 2784033Domain d1vq5t1: 1vq5 T:1-119 [120120]
    Other proteins in same PDB: d1vq511, d1vq521, d1vq531, d1vq5a1, d1vq5a2, d1vq5b1, d1vq5c1, d1vq5d1, d1vq5e1, d1vq5e2, d1vq5f1, d1vq5g1, d1vq5h1, d1vq5i1, d1vq5j1, d1vq5k1, d1vq5l1, d1vq5m1, d1vq5n1, d1vq5o1, d1vq5p1, d1vq5q1, d1vq5r1, d1vq5s1, d1vq5u1, d1vq5v1, d1vq5w1, d1vq5x1, d1vq5y1, d1vq5z1
    automatically matched to d1ffkq_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq5t1

PDB Entry: 1vq5 (more details), 2.6 Å

PDB Description: The structure of the transition state analogue "RAA" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (T:) 50S ribosomal protein L24P

SCOPe Domain Sequences for d1vq5t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq5t1 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

SCOPe Domain Coordinates for d1vq5t1:

Click to download the PDB-style file with coordinates for d1vq5t1.
(The format of our PDB-style files is described here.)

Timeline for d1vq5t1: