Lineage for d1vq5h1 (1vq5 H:1-163)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2945283Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 2945284Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 2945285Protein Ribosomal protein L10e [54688] (2 species)
  7. 2945286Species Haloarcula marismortui [TaxId:2238] [54689] (58 PDB entries)
    Uniprot P60617
  8. 2945298Domain d1vq5h1: 1vq5 H:1-163 [120108]
    Other proteins in same PDB: d1vq511, d1vq521, d1vq531, d1vq5a1, d1vq5a2, d1vq5b1, d1vq5c1, d1vq5d1, d1vq5e1, d1vq5e2, d1vq5f1, d1vq5g1, d1vq5i1, d1vq5j1, d1vq5k1, d1vq5l1, d1vq5m1, d1vq5n1, d1vq5o1, d1vq5p1, d1vq5q1, d1vq5r1, d1vq5s1, d1vq5t1, d1vq5u1, d1vq5v1, d1vq5w1, d1vq5x1, d1vq5y1, d1vq5z1
    automatically matched to d1s72h_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq5h1

PDB Entry: 1vq5 (more details), 2.6 Å

PDB Description: The structure of the transition state analogue "RAA" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (H:) 50S ribosomal protein L10e

SCOPe Domain Sequences for d1vq5h1:

Sequence, based on SEQRES records: (download)

>d1vq5h1 d.41.4.1 (H:1-163) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkqatgagadrvsdgmraafgki
vgtaarvqageqlftaycnvedaehvkeafrraynkitpscri

Sequence, based on observed residues (ATOM records): (download)

>d1vq5h1 d.41.4.1 (H:1-163) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkdgmraafgkivgtaarvqage
qlftaycnvedaehvkeafrraynkitpscri

SCOPe Domain Coordinates for d1vq5h1:

Click to download the PDB-style file with coordinates for d1vq5h1.
(The format of our PDB-style files is described here.)

Timeline for d1vq5h1: