Lineage for d1veoa1 (1veo A:418-516)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768598Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2768737Family b.3.1.0: automated matches [254199] (1 protein)
    not a true family
  6. 2768738Protein automated matches [254436] (5 species)
    not a true protein
  7. Species Bacillus cereus [TaxId:1396] [254918] (3 PDB entries)
  8. 2768742Domain d1veoa1: 1veo A:418-516 [120025]
    Other proteins in same PDB: d1veoa2
    automated match to d1vema1
    complexed with ca, glc

Details for d1veoa1

PDB Entry: 1veo (more details), 2.12 Å

PDB Description: crystal structure analysis of y164f/maltose of bacillus cereus beta- amylase at ph 4.6
PDB Compounds: (A:) beta-amylase

SCOPe Domain Sequences for d1veoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1veoa1 b.3.1.0 (A:418-516) automated matches {Bacillus cereus [TaxId: 1396]}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw

SCOPe Domain Coordinates for d1veoa1:

Click to download the PDB-style file with coordinates for d1veoa1.
(The format of our PDB-style files is described here.)

Timeline for d1veoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1veoa2