Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) |
Family b.3.1.0: automated matches [254199] (1 protein) not a true family |
Protein automated matches [254436] (5 species) not a true protein |
Domain d1veoa1: 1veo A:418-516 [120025] Other proteins in same PDB: d1veoa2 automated match to d1vema1 complexed with ca, glc |
PDB Entry: 1veo (more details), 2.12 Å
SCOPe Domain Sequences for d1veoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1veoa1 b.3.1.0 (A:418-516) automated matches {Bacillus cereus [TaxId: 1396]} tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer niefkafikskdgtvkswqtiqqswnpvplkttshtssw
Timeline for d1veoa1: