Class b: All beta proteins [48724] (174 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.2: Head decoration protein D (gpD, major capsid protein D) [51274] (1 family) automatically mapped to Pfam PF02924 |
Family b.85.2.1: Head decoration protein D (gpD, major capsid protein D) [51275] (1 protein) |
Protein Head decoration protein D (gpD, major capsid protein D) [51276] (2 species) |
Species Bacteriophage lambda [TaxId:10710] [51277] (3 PDB entries) Uniprot P03712 |
Domain d1vd0a1: 1vd0 A:15-109 [119990] automatically matched to d1c5ea_ |
PDB Entry: 1vd0 (more details)
SCOPe Domain Sequences for d1vd0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vd0a1 b.85.2.1 (A:15-109) Head decoration protein D (gpD, major capsid protein D) {Bacteriophage lambda [TaxId: 10710]} sdpahtatapgglsakapamtplmldtssrklvawdgttdgaavgilavaadqtsttltf yksgtfryedvlwpeaasdetkkrtafagtaisiv
Timeline for d1vd0a1: