Lineage for d1vd0a_ (1vd0 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2817951Superfamily b.85.2: Head decoration protein D (gpD, major capsid protein D) [51274] (1 family) (S)
    automatically mapped to Pfam PF02924
  5. 2817952Family b.85.2.1: Head decoration protein D (gpD, major capsid protein D) [51275] (2 proteins)
  6. 2817973Protein automated matches [254435] (1 species)
    not a true protein
  7. 2817974Species Enterobacteria phage [TaxId:10710] [254916] (1 PDB entry)
  8. 2817975Domain d1vd0a_: 1vd0 A: [119990]
    automated match to d1c5ea_

Details for d1vd0a_

PDB Entry: 1vd0 (more details)

PDB Description: capsid stabilizing protein gpd, nmr, 20 structures
PDB Compounds: (A:) Head decoration protein

SCOPe Domain Sequences for d1vd0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vd0a_ b.85.2.1 (A:) automated matches {Enterobacteria phage [TaxId: 10710]}
tsketfthyqpqgnsdpahtatapgglsakapamtplmldtssrklvawdgttdgaavgi
lavaadqtsttltfyksgtfryedvlwpeaasdetkkrtafagtaisiv

SCOPe Domain Coordinates for d1vd0a_:

Click to download the PDB-style file with coordinates for d1vd0a_.
(The format of our PDB-style files is described here.)

Timeline for d1vd0a_: