Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.17: YccV-like [141255] (1 family) contains extra C-terminal helix packed against barrel automatically mapped to Pfam PF08755 |
Family b.34.17.1: YccV-like [141256] (1 protein) |
Protein Hypothetical protein YccV [141257] (1 species) |
Species Escherichia coli [TaxId:562] [141258] (1 PDB entry) Uniprot P0AB20 21-114 |
Domain d1vbva1: 1vbv A:3-97 [119965] |
PDB Entry: 1vbv (more details), 2.7 Å
SCOPe Domain Sequences for d1vbva1:
Sequence, based on SEQRES records: (download)
>d1vbva1 b.34.17.1 (A:3-97) Hypothetical protein YccV {Escherichia coli [TaxId: 562]} askfgigqqvrhsllgylgvvvdidpvyslsepspdelavndelraapwyhvvmeddngl pvhtylaeaqlsselqdehpeqpsmdelaqtirkq
>d1vbva1 b.34.17.1 (A:3-97) Hypothetical protein YccV {Escherichia coli [TaxId: 562]} askfgigqqvrhsllgylgvvvdidpvaapwyhvvmeddnglpvhtylaeaqlsselqde hpeqpsmdelaqtirkq
Timeline for d1vbva1: