Lineage for d1vbva1 (1vbv A:3-97)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2055815Superfamily b.34.17: YccV-like [141255] (1 family) (S)
    contains extra C-terminal helix packed against barrel
    automatically mapped to Pfam PF08755
  5. 2055816Family b.34.17.1: YccV-like [141256] (1 protein)
  6. 2055817Protein Hypothetical protein YccV [141257] (1 species)
  7. 2055818Species Escherichia coli [TaxId:562] [141258] (1 PDB entry)
    Uniprot P0AB20 21-114
  8. 2055819Domain d1vbva1: 1vbv A:3-97 [119965]

Details for d1vbva1

PDB Entry: 1vbv (more details), 2.7 Å

PDB Description: crystal structure of hypothetical protein from esherichia coli
PDB Compounds: (A:) hypothetical protein b0966

SCOPe Domain Sequences for d1vbva1:

Sequence, based on SEQRES records: (download)

>d1vbva1 b.34.17.1 (A:3-97) Hypothetical protein YccV {Escherichia coli [TaxId: 562]}
askfgigqqvrhsllgylgvvvdidpvyslsepspdelavndelraapwyhvvmeddngl
pvhtylaeaqlsselqdehpeqpsmdelaqtirkq

Sequence, based on observed residues (ATOM records): (download)

>d1vbva1 b.34.17.1 (A:3-97) Hypothetical protein YccV {Escherichia coli [TaxId: 562]}
askfgigqqvrhsllgylgvvvdidpvaapwyhvvmeddnglpvhtylaeaqlsselqde
hpeqpsmdelaqtirkq

SCOPe Domain Coordinates for d1vbva1:

Click to download the PDB-style file with coordinates for d1vbva1.
(The format of our PDB-style files is described here.)

Timeline for d1vbva1: