Lineage for d1vbga3 (1vbg A:3-382)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219586Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1219587Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families) (S)
  5. 1219807Family d.142.1.5: Pyruvate phosphate dikinase, N-terminal domain [56085] (1 protein)
  6. 1219808Protein Pyruvate phosphate dikinase, N-terminal domain [56086] (3 species)
    the common fold is interrupted by a 4-helical subdomain (residues 112-198)
  7. 1219817Species Maize (Zea mays) [TaxId:4577] [143889] (2 PDB entries)
    Uniprot P11155 74-453
  8. 1219818Domain d1vbga3: 1vbg A:3-382 [119953]
    Other proteins in same PDB: d1vbga1, d1vbga2
    complexed with mg, so4

Details for d1vbga3

PDB Entry: 1vbg (more details), 2.3 Å

PDB Description: pyruvate phosphate dikinase from maize
PDB Compounds: (A:) pyruvate,orthophosphate dikinase

SCOPe Domain Sequences for d1vbga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbga3 d.142.1.5 (A:3-382) Pyruvate phosphate dikinase, N-terminal domain {Maize (Zea mays) [TaxId: 4577]}
kkrvfhfgkgksegnktmkellggkganlaemasiglsvppgftvsteacqqyqdagcal
paglwaeivdglqwveeymgatlgdpqrplllsvrsgaavsmpgmmdtvlnlglndevaa
glaaksgerfaydsfrrfldmfgnvvmdiprslfeeklehmkeskglkndtdltasdlke
lvgqykevylsakgepfpsdpkkqlelavlavfnswesprakkyrsinqitglrgtavnv
qcmvfgnmgntsgtgvlftrnpntgekklygeflvnaqgedvvagirtpedldamknlmp
qaydelvencnileshykemqdieftvqenrlwmlqcrtgkrtgksavkiavdmvneglv
eprsaikmvepghldqllhp

SCOPe Domain Coordinates for d1vbga3:

Click to download the PDB-style file with coordinates for d1vbga3.
(The format of our PDB-style files is described here.)

Timeline for d1vbga3: