SCOPe 2.01: Domain d1vaxe2: 1vax E:11-141

Lineage for d1vaxe2 (1vax E:11-141)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.4: Urate oxidase (uricase) [55633] (1 protein)

6. Protein Urate oxidase (uricase) [55634] (3 species)
   duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16

7. Species Arthrobacter globiformis [TaxId:1665] [143630] (6 PDB entries)

8. Domain d1vaxe2: 1vax E:11-141 [119919]
   automatically matched to 1VAX A:11-141

Details for d1vaxe2

PDB Entry: 1vax, 1.99 Å

PDB Description: Crystal Structure of Uricase from Arthrobacter globiformis

PDB Compounds: (E:) Uric acid oxidase

SCOPe Domain Sequences for d1vaxe2:

Sequence; same for both SEQRES and ATOM records:

>d1vaxe2 d.96.1.4 (E:11-141) Urate oxidase (uricase) {Arthrobacter globiformis [TaxId: 1665]}
tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
evrtavleisg

Timeline for d1vaxe2:

• d1vaxe2 first appeared in SCOP 1.73
  
• d1vaxe2 appears in SCOP 1.75
  
• d1vaxe2 appears in SCOPe 2.02
  
• d1vaxe2 appears in the current release, SCOPe 2.08