Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.309: AMMECR1-like [143446] (1 superfamily) duplication; contains two beta(2)-alpha-beta(2) structural repeats, swapped with C-terminal strands; extra N-terminal helix and C-terminal strand |
Superfamily d.309.1: AMMECR1-like [143447] (1 family) automatically mapped to Pfam PF01871 |
Family d.309.1.1: AMMECR1-like [143448] (4 proteins) Pfam PF01871 |
Protein Hypothetical protein PH0010 [143451] (1 species) |
Species Pyrococcus horikoshii [TaxId:53953] [143452] (1 PDB entry) Uniprot O57770 3-205 |
Domain d1vaja1: 1vaj A:3-205 [119907] |
PDB Entry: 1vaj (more details), 1.82 Å
SCOPe Domain Sequences for d1vaja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vaja1 d.309.1.1 (A:3-205) Hypothetical protein PH0010 {Pyrococcus horikoshii [TaxId: 53953]} fkikdewgeflvrlarraieeylktgkeieppkdtppelwekmgvfvtlnrynvppqtal rgcigfptpiyplveatikaaiysavddprfppvkleemdnlvvevsvltppeliegppe erprkikvgrdglivekgiysglllpqvpvewgwdeeeflaetcwkaglppdcwldedtk vykftaeifeeeyprgpikrkpl
Timeline for d1vaja1: