Lineage for d1vaja1 (1vaj A:3-205)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010585Fold d.309: AMMECR1-like [143446] (1 superfamily)
    duplication; contains two beta(2)-alpha-beta(2) structural repeats, swapped with C-terminal strands; extra N-terminal helix and C-terminal strand
  4. 3010586Superfamily d.309.1: AMMECR1-like [143447] (1 family) (S)
    automatically mapped to Pfam PF01871
  5. 3010587Family d.309.1.1: AMMECR1-like [143448] (4 proteins)
    Pfam PF01871
  6. 3010591Protein Hypothetical protein PH0010 [143451] (1 species)
  7. 3010592Species Pyrococcus horikoshii [TaxId:53953] [143452] (1 PDB entry)
    Uniprot O57770 3-205
  8. 3010593Domain d1vaja1: 1vaj A:3-205 [119907]

Details for d1vaja1

PDB Entry: 1vaj (more details), 1.82 Å

PDB Description: Crystal Structure of Uncharacterized Protein PH0010 From Pyrococcus horikoshii
PDB Compounds: (A:) Hypothetical protein PH0010

SCOPe Domain Sequences for d1vaja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vaja1 d.309.1.1 (A:3-205) Hypothetical protein PH0010 {Pyrococcus horikoshii [TaxId: 53953]}
fkikdewgeflvrlarraieeylktgkeieppkdtppelwekmgvfvtlnrynvppqtal
rgcigfptpiyplveatikaaiysavddprfppvkleemdnlvvevsvltppeliegppe
erprkikvgrdglivekgiysglllpqvpvewgwdeeeflaetcwkaglppdcwldedtk
vykftaeifeeeyprgpikrkpl

SCOPe Domain Coordinates for d1vaja1:

Click to download the PDB-style file with coordinates for d1vaja1.
(The format of our PDB-style files is described here.)

Timeline for d1vaja1: