PDB entry 1vaj

View 1vaj on RCSB PDB site
Description: Crystal Structure of Uncharacterized Protein PH0010 From Pyrococcus horikoshii
Class: structural genomics, unknown function
Keywords: alpha + beta fold, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2004-02-17, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.202
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein PH0010
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0010
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57770
      • modified residue (44)
      • modified residue (100)
    Domains in SCOPe 2.07: d1vaja1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vajA (A:)
    mvfkikdewgeflvrlarraieeylktgkeieppkdtppelwekmgvfvtlnrynvppqt
    alrgcigfptpiyplveatikaaiysavddprfppvkleemdnlvvevsvltppeliegp
    peerprkikvgrdglivekgiysglllpqvpvewgwdeeeflaetcwkaglppdcwlded
    tkvykftaeifeeeyprgpikrkplvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vajA (A:)
    fkikdewgeflvrlarraieeylktgkeieppkdtppelwekmgvfvtlnrynvppqtal
    rgcigfptpiyplveatikaaiysavddprfppvkleemdnlvvevsvltppeliegppe
    erprkikvgrdglivekgiysglllpqvpvewgwdeeeflaetcwkaglppdcwldedtk
    vykftaeifeeeyprgpikrkpl