Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) |
Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
Protein automated matches [190067] (6 species) not a true protein |
Species Streptococcus sp. [TaxId:1306] [186786] (4 PDB entries) |
Domain d1uwxa_: 1uwx A: [119765] Other proteins in same PDB: d1uwxh1, d1uwxm1 automated match to d2igg__ |
PDB Entry: 1uwx (more details), 2.2 Å
SCOPe Domain Sequences for d1uwxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uwxa_ d.15.7.1 (A:) automated matches {Streptococcus sp. [TaxId: 1306]} vttyklvingktlkgetttkavdaataekvfkqyandngvdgewtyddatktftvtek
Timeline for d1uwxa_: