Lineage for d1uwxa_ (1uwx A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934642Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2934643Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2934772Protein automated matches [190067] (6 species)
    not a true protein
  7. 2934793Species Streptococcus sp. [TaxId:1306] [186786] (4 PDB entries)
  8. 2934794Domain d1uwxa_: 1uwx A: [119765]
    Other proteins in same PDB: d1uwxh1, d1uwxm1
    automated match to d2igg__

Details for d1uwxa_

PDB Entry: 1uwx (more details), 2.2 Å

PDB Description: p1.2 serosubtype antigen derived from n. meningitidis pora in complex with fab fragment
PDB Compounds: (A:) protein g-prime

SCOPe Domain Sequences for d1uwxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwxa_ d.15.7.1 (A:) automated matches {Streptococcus sp. [TaxId: 1306]}
vttyklvingktlkgetttkavdaataekvfkqyandngvdgewtyddatktftvtek

SCOPe Domain Coordinates for d1uwxa_:

Click to download the PDB-style file with coordinates for d1uwxa_.
(The format of our PDB-style files is described here.)

Timeline for d1uwxa_: