Lineage for d1uwxb_ (1uwx B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934642Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2934643Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2934772Protein automated matches [190067] (6 species)
    not a true protein
  7. 2934793Species Streptococcus sp. [TaxId:1306] [186786] (4 PDB entries)
  8. 2934795Domain d1uwxb_: 1uwx B: [119766]
    Other proteins in same PDB: d1uwxh1, d1uwxm1
    automated match to d2igg__

Details for d1uwxb_

PDB Entry: 1uwx (more details), 2.2 Å

PDB Description: p1.2 serosubtype antigen derived from n. meningitidis pora in complex with fab fragment
PDB Compounds: (B:) protein g-prime

SCOPe Domain Sequences for d1uwxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwxb_ d.15.7.1 (B:) automated matches {Streptococcus sp. [TaxId: 1306]}
vttyklvingktlkgetttkavdaataekvfkqyandngvdgewtyddatktftvtekpe

SCOPe Domain Coordinates for d1uwxb_:

Click to download the PDB-style file with coordinates for d1uwxb_.
(The format of our PDB-style files is described here.)

Timeline for d1uwxb_: