Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (18 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (9 PDB entries) |
Domain d1uwah2: 1uwa H:7-149 [119743] Other proteins in same PDB: d1uwaa1, d1uwab1, d1uwac_, d1uwae1, d1uwaf_, d1uwah1, d1uwai_, d1uwaj_, d1uwak1, d1uwam_, d1uwao1, d1uwap_, d1uwar1, d1uwat_, d1uwav1, d1uwaw_ automated match to d1gk8a2 complexed with cap, edo, mg; mutant |
PDB Entry: 1uwa (more details), 2.3 Å
SCOPe Domain Sequences for d1uwah2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uwah2 d.58.9.0 (H:7-149) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} tkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtw ttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfg fkalralrledlrippayvktfv
Timeline for d1uwah2: