Lineage for d1u85a1 (1u85 A:3-33)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749946Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily)
    alpha+beta metal(zinc)-bound fold: beta-hairpin + alpha-helix
  4. 749947Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (6 families) (S)
  5. 749948Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins)
  6. 749980Protein Kruppel-like factor 3, Bklf [103597] (1 species)
  7. 749981Species Mouse (Mus musculus) [TaxId:10090] [103598] (3 PDB entries)
  8. 749982Domain d1u85a1: 1u85 A:3-33 [119623]
    complexed with zn; mutant

Details for d1u85a1

PDB Entry: 1u85 (more details)

PDB Description: arg326-trp mutant of the third zinc finger of bklf
PDB Compounds: (A:) Kruppel-like factor 3

SCOP Domain Sequences for d1u85a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u85a1 g.37.1.1 (A:3-33) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]}
tgikpfqcpdcdwsfsrsdhlalhrkrhmlv

SCOP Domain Coordinates for d1u85a1:

Click to download the PDB-style file with coordinates for d1u85a1.
(The format of our PDB-style files is described here.)

Timeline for d1u85a1: