Lineage for d1u5ca2 (1u5c A:165-329)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2232530Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2232895Protein automated matches [226882] (7 species)
    not a true protein
  7. 2232955Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [254909] (5 PDB entries)
  8. 2232960Domain d1u5ca2: 1u5c A:165-329 [119535]
    Other proteins in same PDB: d1u5ca1, d1u5ca3
    automated match to d1t2da2
    complexed with bik, nad

Details for d1u5ca2

PDB Entry: 1u5c (more details), 2.65 Å

PDB Description: Plasmodium falciparum lactate dehydrogenase complexed with 3,7-dihydroxynaphthalene-2-carboxylic acid and NAD+
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1u5ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5ca2 d.162.1.1 (A:165-329) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
gvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklisd
aeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqyghs
difggtpvvlgangveqvielqlnseekakfdeaiaetkrmkala

SCOPe Domain Coordinates for d1u5ca2:

Click to download the PDB-style file with coordinates for d1u5ca2.
(The format of our PDB-style files is described here.)

Timeline for d1u5ca2: