| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
| Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (11 PDB entries) probably orthologous to the human HLA-DQ group |
| Domain d1u3hh1: 1u3h H:94-190 [119516] Other proteins in same PDB: d1u3hc1, d1u3hc2, d1u3hd2, d1u3hg1, d1u3hg2, d1u3hh2 automatically matched to d1f3jb1 mutant |
PDB Entry: 1u3h (more details), 2.42 Å
SCOP Domain Sequences for d1u3hh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3hh1 b.1.1.2 (H:94-190) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtprrgevytchvehpslkspitvewra
Timeline for d1u3hh1: