Lineage for d1u3hh1 (1u3h H:94-190)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654956Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 655024Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (11 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 655030Domain d1u3hh1: 1u3h H:94-190 [119516]
    Other proteins in same PDB: d1u3hc1, d1u3hc2, d1u3hd2, d1u3hg1, d1u3hg2, d1u3hh2
    automatically matched to d1f3jb1
    mutant

Details for d1u3hh1

PDB Entry: 1u3h (more details), 2.42 Å

PDB Description: crystal structure of mouse tcr 172.10 complexed with mhc class ii i-au molecule at 2.4 a
PDB Compounds: (H:) H-2 class II histocompatibility antigen, A-U beta chain

SCOP Domain Sequences for d1u3hh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3hh1 b.1.1.2 (H:94-190) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtprrgevytchvehpslkspitvewra

SCOP Domain Coordinates for d1u3hh1:

Click to download the PDB-style file with coordinates for d1u3hh1.
(The format of our PDB-style files is described here.)

Timeline for d1u3hh1: