Lineage for d1u3hg1 (1u3h G:82-181)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654849Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 654899Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (20 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 654907Domain d1u3hg1: 1u3h G:82-181 [119514]
    Other proteins in same PDB: d1u3hc2, d1u3hd1, d1u3hd2, d1u3hg2, d1u3hh1, d1u3hh2
    automatically matched to d1k2da1
    mutant

Details for d1u3hg1

PDB Entry: 1u3h (more details), 2.42 Å

PDB Description: Crystal structure of mouse TCR 172.10 complexed with MHC class II I-Au molecule at 2.4 A
PDB Compounds: (G:) H-2 class II histocompatibility antigen, A-U alpha chain

SCOP Domain Sequences for d1u3hg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3hg1 b.1.1.2 (G:82-181) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwepe

SCOP Domain Coordinates for d1u3hg1:

Click to download the PDB-style file with coordinates for d1u3hg1.
(The format of our PDB-style files is described here.)

Timeline for d1u3hg1: