Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
Protein macro-H2A.1, histone domain [140396] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140397] (2 PDB entries) Uniprot O75367 11-116 |
Domain d1u35g1: 1u35 G:1014-1119 [119499] Other proteins in same PDB: d1u35a1, d1u35b1, d1u35d1, d1u35e1, d1u35f1, d1u35h1 automatically matched to 1U35 C:814-919 |
PDB Entry: 1u35 (more details), 3 Å
SCOP Domain Sequences for d1u35g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u35g1 a.22.1.1 (G:1014-1119) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} ktsrsakagvifpvgrmlryikkghpkyrigvgapvymaavleyltaeilelavnaardn kkgrvtprhillavandeelnqllkgvtiasggvlpnihpellakk
Timeline for d1u35g1: