SCOP 1.73: Domain d1u35g1: 1u35 G:1014-1119

Lineage for d1u35g1 (1u35 G:1014-1119)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein macro-H2A.1, histone domain [140396] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140397] (2 PDB entries)

8. Domain d1u35g1: 1u35 G:1014-1119 [119499]
   Other proteins in same PDB: d1u35a1, d1u35b1, d1u35d1, d1u35e1, d1u35f1, d1u35h1
   automatically matched to 1U35 C:814-919

Details for d1u35g1

PDB Entry: 1u35, 3 Å

PDB Description: crystal structure of the nucleosome core particle containing the histone domain of macroh2a

PDB Compounds: (G:) H2A histone family

SCOP Domain Sequences for d1u35g1:

Sequence; same for both SEQRES and ATOM records:

>d1u35g1 a.22.1.1 (G:1014-1119) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]}
ktsrsakagvifpvgrmlryikkghpkyrigvgapvymaavleyltaeilelavnaardn
kkgrvtprhillavandeelnqllkgvtiasggvlpnihpellakk

Timeline for d1u35g1:

• d1u35g1 is new in SCOP 1.73
  
• d1u35g1 appears in SCOP 1.75
  
• d1u35g1 appears in the current release, SCOPe 2.08, called d1u35g_