Lineage for d1u2wd_ (1u2w D:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1478682Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 1478683Protein Cadmium efflux system accessory protein CadC [140239] (1 species)
  7. 1478684Species Staphylococcus aureus [TaxId:1280] [140240] (1 PDB entry)
    Uniprot P20047 12-119
  8. 1478688Domain d1u2wd_: 1u2w D: [119490]
    automated match to d1u2wa1
    complexed with zn

Details for d1u2wd_

PDB Entry: 1u2w (more details), 1.9 Å

PDB Description: crystal structure of the staphylococcus aureus pi258 cadc
PDB Compounds: (D:) Cadmium efflux system accessory protein

SCOPe Domain Sequences for d1u2wd_:

Sequence, based on SEQRES records: (download)

>d1u2wd_ a.4.5.5 (D:) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]}
gydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvti
anashhlrtlykqgvvnfrkegklalyslgdehirqimmialahkkev

Sequence, based on observed residues (ATOM records): (download)

>d1u2wd_ a.4.5.5 (D:) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]}
gydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvti
anashhlrtlylyslgdehirqimmialahkkev

SCOPe Domain Coordinates for d1u2wd_:

Click to download the PDB-style file with coordinates for d1u2wd_.
(The format of our PDB-style files is described here.)

Timeline for d1u2wd_: