![]() | Class j: Peptides [58231] (120 folds) |
![]() | Fold j.6: Peptide hormones [58283] (1 superfamily) contains one alpha-helix |
![]() | Superfamily j.6.1: Peptide hormones [58284] (1 family) ![]() this is not a true superfamily |
![]() | Family j.6.1.1: Peptide hormones [58285] (19 proteins) |
![]() | Protein Neuropeptide Y [58289] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [58290] (2 PDB entries) |
![]() | Domain d1tz5a1: 1tz5 A:1-36 [119393] Chimera of pancreatic hormone and neuropeptide Y |
PDB Entry: 1tz5 (more details)
SCOPe Domain Sequences for d1tz5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tz5a1 j.6.1.1 (A:1-36) Neuropeptide Y {Human (Homo sapiens) [TaxId: 9606]} aplepvypgdnatpeqmaryysalrryinmltrpry
Timeline for d1tz5a1: