Lineage for d1tuub2 (1tuu B:198-398)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1171251Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 1171559Family c.55.1.2: Acetokinase-like [53080] (3 proteins)
  6. 1171560Protein Acetate kinase [53081] (1 species)
  7. 1171561Species Methanosarcina thermophila [TaxId:2210] [53082] (3 PDB entries)
    Uniprot P38502 1-399
  8. 1171569Domain d1tuub2: 1tuu B:198-398 [119346]
    automatically matched to d1g99a2
    complexed with adp, amp, nh4, pis, so4

Details for d1tuub2

PDB Entry: 1tuu (more details), 2.5 Å

PDB Description: acetate kinase crystallized with atpgs
PDB Compounds: (B:) acetate kinase

SCOPe Domain Sequences for d1tuub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuub2 c.55.1.2 (B:198-398) Acetate kinase {Methanosarcina thermophila [TaxId: 2210]}
paeetkiitchlgngssitaveggksvetsmgftpleglamgtrcgsidpaivpflmeke
glttreidtlmnkksgvlgvsglsndfrdldeaaskgnrkaelaleifaykvkkfigeys
avlngadavvftagigensasirkriltgldgigikiddeknkirgqeidistpdakvrv
fviptneelaiaretkeivet

SCOPe Domain Coordinates for d1tuub2:

Click to download the PDB-style file with coordinates for d1tuub2.
(The format of our PDB-style files is described here.)

Timeline for d1tuub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tuub1