Lineage for d1tija1 (1tij A:10-120)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1404617Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 1404650Family d.17.1.2: Cystatins [54407] (7 proteins)
    automatically mapped to Pfam PF00031
  6. 1404684Protein Cystatin C [64231] (1 species)
  7. 1404685Species Human (Homo sapiens) [TaxId:9606] [64232] (8 PDB entries)
    Uniprot P01034 37-146
  8. 1404705Domain d1tija1: 1tij A:10-120 [119281]
    automatically matched to d1g96a_

Details for d1tija1

PDB Entry: 1tij (more details), 3.03 Å

PDB Description: 3D Domain-swapped human cystatin C with amyloid-like intermolecular beta-sheets
PDB Compounds: (A:) Cystatin C

SCOPe Domain Sequences for d1tija1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tija1 d.17.1.2 (A:10-120) Cystatin C {Human (Homo sapiens) [TaxId: 9606]}
vggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvelg
rttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda

SCOPe Domain Coordinates for d1tija1:

Click to download the PDB-style file with coordinates for d1tija1.
(The format of our PDB-style files is described here.)

Timeline for d1tija1: