Lineage for d1tija_ (1tij A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2504826Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2504827Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2504864Family d.17.1.2: Cystatins [54407] (7 proteins)
    automatically mapped to Pfam PF00031
  6. 2504898Protein Cystatin C [64231] (1 species)
  7. 2504899Species Human (Homo sapiens) [TaxId:9606] [64232] (9 PDB entries)
    Uniprot P01034 37-146
  8. 2504918Domain d1tija_: 1tij A: [119281]
    automated match to d1g96a_

Details for d1tija_

PDB Entry: 1tij (more details), 3.03 Å

PDB Description: 3D Domain-swapped human cystatin C with amyloid-like intermolecular beta-sheets
PDB Compounds: (A:) Cystatin C

SCOPe Domain Sequences for d1tija_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tija_ d.17.1.2 (A:) Cystatin C {Human (Homo sapiens) [TaxId: 9606]}
prlvggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldv
elgrttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda

SCOPe Domain Coordinates for d1tija_:

Click to download the PDB-style file with coordinates for d1tija_.
(The format of our PDB-style files is described here.)

Timeline for d1tija_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tijb_