Lineage for d1tg6f_ (1tg6 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2852295Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2852296Protein Clp protease, ClpP subunit [52098] (11 species)
  7. 2852398Species Human (Homo sapiens), mitochondrial [TaxId:9606] [141995] (4 PDB entries)
    Uniprot Q16740 57-249
  8. 2852411Domain d1tg6f_: 1tg6 F: [119241]
    automated match to d1tg6a1
    complexed with dio, edo, fme, gol

Details for d1tg6f_

PDB Entry: 1tg6 (more details), 2.1 Å

PDB Description: crystallography and mutagenesis point to an essential role for the n- terminus of human mitochondrial clpp
PDB Compounds: (F:) Putative ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d1tg6f_:

Sequence, based on SEQRES records: (download)

>d1tg6f_ c.14.1.1 (F:) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
plipivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpih
myinspggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrim
ihqpsggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaq
efgildkvlvhppqdg

Sequence, based on observed residues (ATOM records): (download)

>d1tg6f_ c.14.1.1 (F:) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
plipivvydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmyinspggv
vtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpsggar
gqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgildkvl
vhppqdg

SCOPe Domain Coordinates for d1tg6f_:

Click to download the PDB-style file with coordinates for d1tg6f_.
(The format of our PDB-style files is described here.)

Timeline for d1tg6f_: