Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein Clp protease, ClpP subunit [52098] (11 species) |
Species Human (Homo sapiens), mitochondrial [TaxId:9606] [141995] (4 PDB entries) Uniprot Q16740 57-249 |
Domain d1tg6f_: 1tg6 F: [119241] automated match to d1tg6a1 complexed with dio, edo, fme, gol |
PDB Entry: 1tg6 (more details), 2.1 Å
SCOPe Domain Sequences for d1tg6f_:
Sequence, based on SEQRES records: (download)
>d1tg6f_ c.14.1.1 (F:) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} plipivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpih myinspggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrim ihqpsggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaq efgildkvlvhppqdg
>d1tg6f_ c.14.1.1 (F:) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} plipivvydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmyinspggv vtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpsggar gqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgildkvl vhppqdg
Timeline for d1tg6f_: