Lineage for d1tfta1 (1tft A:240-356)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1067283Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 1067284Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) (S)
  5. 1067285Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 1067331Protein BIR domains of XIAP [57928] (1 species)
  7. 1067332Species Human (Homo sapiens) [TaxId:9606] [57929] (14 PDB entries)
    Uniprot P98170 241-356
  8. 1067361Domain d1tfta1: 1tft A:240-356 [119235]
    automatically matched to d1f9xa_
    complexed with 997, zn

Details for d1tfta1

PDB Entry: 1tft (more details)

PDB Description: nmr structure of an antagonists of the xiap-caspase-9 interaction complexed to the bir3 domain of xiap
PDB Compounds: (A:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d1tfta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfta1 g.52.1.1 (A:240-356) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
msdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvk
cfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt

SCOPe Domain Coordinates for d1tfta1:

Click to download the PDB-style file with coordinates for d1tfta1.
(The format of our PDB-style files is described here.)

Timeline for d1tfta1: