Lineage for d1t63a_ (1t63 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923260Protein Androgen receptor [63621] (4 species)
  7. 923270Species Human (Homo sapiens) [TaxId:9606] [63623] (46 PDB entries)
    Uniprot P10275 671-919
  8. 923299Domain d1t63a_: 1t63 A: [119158]
    automated match to d1e3ga_
    complexed with dht

Details for d1t63a_

PDB Entry: 1t63 (more details), 2.07 Å

PDB Description: crystal structure of the androgen receptor ligand binding domain with dht and a peptide derived from its physiological coactivator grip1 nr box3
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d1t63a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t63a_ a.123.1.1 (A:) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
cqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnl
hvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmr
hlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrkn
ptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkils
gkvkpiyfht

SCOPe Domain Coordinates for d1t63a_:

Click to download the PDB-style file with coordinates for d1t63a_.
(The format of our PDB-style files is described here.)

Timeline for d1t63a_: