SCOPe 2.08: Domain d1sqvb1: 1sqv B:17-235

Lineage for d1sqvb1 (1sqv B:17-235)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (7 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 2 [63409] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56000] (19 PDB entries)
   Uniprot P23004

8. Domain d1sqvb1: 1sqv B:17-235 [119022]
   Other proteins in same PDB: d1sqva1, d1sqva2, d1sqvc1, d1sqvc2, d1sqvd1, d1sqvd2, d1sqve1, d1sqve2, d1sqvf_, d1sqvg_, d1sqvh_, d1sqvi_, d1sqvj_, d1sqvk_
   automated match to d1ppjb1
   complexed with fes, hec, uhd, uq2

Details for d1sqvb1

PDB Entry: 1sqv, 2.85 Å

PDB Description: crystal structure analysis of bovine bc1 with uhdbt

PDB Compounds: (B:) Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial

SCOPe Domain Sequences for d1sqvb1:

Sequence; same for both SEQRES and ATOM records:

>d1sqvb1 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]}
vpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslt
tkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwe
vaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvq
nhftsarmaliglgvshpvlkqvaeqflnirgglglsga

Timeline for d1sqvb1:

• d1sqvb1 first appeared in SCOP 1.73
  
• d1sqvb1 appears in SCOPe 2.07