SCOPe 2.07: Domain d1sqqh_: 1sqq H:

Lineage for d1sqqh_ (1sqq H:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family)
   location - intermembrane side of the bc1 complex
   automatically mapped to Pfam PF02320

5. Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
   "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1

6. Protein automated matches [190042] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186764] (7 PDB entries)

8. Domain d1sqqh_: 1sqq H: [119017]
   Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqe1, d1sqqe2, d1sqqf1, d1sqqg_, d1sqqi_, d1sqqj_, d1sqqk1
   automated match to d1l0lh_
   complexed with fes, hem, ost, uq2

Details for d1sqqh_

PDB Entry: 1sqq, 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)

PDB Compounds: (H:) Ubiquinol-cytochrome c reductase complex 11 kDa protein

SCOPe Domain Sequences for d1sqqh_:

Sequence; same for both SEQRES and ATOM records:

>d1sqqh_ f.28.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
eeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhc
vahklfnslk

Timeline for d1sqqh_:

• d1sqqh_ first appeared in SCOP 1.73, called d1sqqh1
  
• d1sqqh_ appears in SCOPe 2.06
  
• d1sqqh_ appears in the current release, SCOPe 2.08