SCOPe 2.01: Domain d1si6x_: 1si6 X:

Lineage for d1si6x_ (1si6 X:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.2: Inositol polyphosphate 5-phosphatase (IPP5) [64422] (3 proteins)

6. Protein automated matches [190040] (1 species)
   not a true protein

7. Species Bedbug (Cimex lectularius) [TaxId:79782] [186761] (3 PDB entries)

8. Domain d1si6x_: 1si6 X: [118968]
   automated match to d1ntfa_
   complexed with cmo, hem

Details for d1si6x_

PDB Entry: 1si6, 1.45 Å

PDB Description: Crystal structure of cimex nitrophorin complex with CO

PDB Compounds: (X:) Salivary nitrophorin

SCOPe Domain Sequences for d1si6x_:

Sequence; same for both SEQRES and ATOM records:

>d1si6x_ d.151.1.2 (X:) automated matches {Bedbug (Cimex lectularius) [TaxId: 79782]}
ppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk
nfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf
tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath
akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt
dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl

Timeline for d1si6x_:

• d1si6x_ first appeared in SCOP 1.73, called d1si6x1
  
• d1si6x_ was called d1si6x1 in SCOP 1.75
  
• d1si6x_ appears in SCOPe 2.02
  
• d1si6x_ appears in the current release, SCOPe 2.08