![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily) sandwich; 6 strands in 2 sheets |
![]() | Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (2 families) ![]() |
![]() | Family b.105.1.1: PBP5 C-terminal domain-like [69190] (2 proteins) |
![]() | Protein Penicillin-binding protein 5, C-terminal domain [69191] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [69192] (8 PDB entries) |
![]() | Domain d1sdna1: 1sdn A:263-355 [118949] Other proteins in same PDB: d1sdna2 automatically matched to d1hd8a1 complexed with hg; mutant |
PDB Entry: 1sdn (more details), 2.5 Å
SCOPe Domain Sequences for d1sdna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sdna1 b.105.1.1 (A:263-355) Penicillin-binding protein 5, C-terminal domain {Escherichia coli [TaxId: 562]} fetvnplkvgkefasepvwfgdsdraslgvdkdvyltiprgrmkdlkasyvlnsselhap lqknqvvgtinfqldgktieqrplvvlqeipeg
Timeline for d1sdna1: